Structure of PDB 4v6e Chain CN

Receptor sequence
>4v6eCN (length=95) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNRWNAVLKLQTLPRDSS
PSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
3D structure
PDB4v6e Structures of the ribosome in intermediate States of ratcheting.
ChainCN
Resolution3.712 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CN A1 K2 S4 M5 R8 R12 V33 R52 D53 S57 R58 R60 N61 T66 R68 H70 F72 R74 I81 R84 K97 S99 A1 K2 S4 M5 R8 R12 V33 R47 D48 S52 R53 R55 N56 T61 R63 H65 F67 R69 I76 R79 K92 S94
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v6e, PDBe:4v6e, PDBj:4v6e
PDBsum4v6e
PubMed19696352
UniProtP0AG59|RS14_ECOLI Small ribosomal subunit protein uS14 (Gene Name=rpsN)

[Back to BioLiP]