Structure of PDB 4v50 Chain CN

Receptor sequence
>4v50CN (length=96) Species: 562 (Escherichia coli) [Search protein sequence]
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNARWNAVLKLQTLPRDS
SPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
3D structure
PDB4v50 Structural basis for mRNA and tRNA positioning on the ribosome.
ChainCN
Resolution3.22 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CN A1 K2 Q3 S4 A7 R8 V33 Q48 T49 R52 S55 R58 R62 R68 H70 F72 R74 R80 I81 R84 S99 W100 A1 K2 Q3 S4 A7 R8 V33 Q44 T45 R48 S51 R54 R58 R64 H66 F68 R70 R76 I77 R80 S95 W96
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v50, PDBe:4v50, PDBj:4v50
PDBsum4v50
PubMed17038497
UniProtP0AG59|RS14_ECOLI Small ribosomal subunit protein uS14 (Gene Name=rpsN)

[Back to BioLiP]