Structure of PDB 4w29 Chain CM

Receptor sequence

>4w29CM (length=125) Species: 262724 (Thermus thermophilus HB27)

ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRKTVAGKKKAPRK

3D structure

• PDB: 4w29 How the ribosome hands the A-site tRNA to the P site during EF-G-catalyzed translocation.
• Chain: CM
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CM	R14 V17 Y21 Y23 G24 I25 G26 R29 Y87 R91 L96 V98 R99 Q101 R102 T103 R104 T105 N106 R108 T109 K111 P113 R114 K115 V117 G119 K120 K122 P124 R125 K126	R13 V16 Y20 Y22 G23 I24 G25 R28 Y86 R90 L95 V97 R98 Q100 R101 T102 R103 T104 N105 R107 T108 K110 P112 R113 K114 V116 G118 K119 K121 P123 R124 K125
BS02	rna	CM	T116 A118 K122 K126	T115 A117 K121 K125
BS03	rna	CM	K121 A123 P124 K126	K120 A122 P123 K125

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4w29, PDBe:4w29, PDBj:4w29
• PDBsum: 4w29
• PubMed: 25190797
• UniProt: P62655|RS13_THET2 Small ribosomal subunit protein uS13 (Gene Name=rpsM)