Structure of PDB 4u1v Chain CM

Receptor sequence
>4u1vCM (length=114) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKP
3D structure
PDB4u1v Synergy of streptogramin antibiotics occurs independently of their effects on translation.
ChainCM
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CM H14 I17 Y23 G24 V25 G26 T28 R29 I73 Y86 R90 H91 L95 P96 V97 R98 G99 Q100 R101 T102 K103 N105 R107 T108 R109 K110 R113 P115 H13 I16 Y22 G23 V24 G25 T27 R28 I72 Y85 R89 H90 L94 P95 V96 R97 G98 Q99 R100 T101 K102 N104 R106 T107 R108 K109 R112 P114
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4u1v, PDBe:4u1v, PDBj:4u1v
PDBsum4u1v
PubMed24957822
UniProtP0A7S9|RS13_ECOLI Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]