Structure of PDB 4bts Chain CM

Receptor sequence

>4btsCM (length=153) Species: 5911 (Tetrahymena thermophila)

SFVIEKESDFKYIHRILNTNIDGKRITPIALTGIRGIGRRFAYIICKVLK
IDPNARAGLLTEDQCNKITDLIADPEAHGIPTWLLNRINDFKDGKNYQMA
SNTLDTKMREDLERLKKIKSHRGLRHFWGLKVRGQHTKTSGRHGVVCGVV
RKN

3D structure

• PDB: 4bts The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
• Chain: CM
• Resolution: 3.703 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CM	R26 I30 R36 G37 I38 G39 R41 F42 W84 L85 L86 N87 I89 M109 D112 H122 R123 R126 H127 L131 K132 V133 R134 G135 Q136 H137 T138 K139 T140 S141 G142 R143 H144 C148 G149 V151 K153	R25 I29 R35 G36 I37 G38 R40 F41 W83 L84 L85 N86 I88 M108 D111 H121 R122 R125 H126 L130 K131 V132 R133 G134 Q135 H136 T137 K138 T139 S140 G141 R142 H143 C147 G148 V150 K152

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4bts, PDBe:4bts, PDBj:4bts
• PDBsum: 4bts
• PubMed: 23851459
• UniProt: E6PBT6