Structure of PDB 9bh5 Chain CL

Receptor sequence

>9bh5CL (length=204) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]

APRGNQMLGNAHFRKHWHKRIKTWFDQPARKLRRRQNRQAKAVEIAPRPV
AGLLRSVVRCPQKRYNTKTRLGRGFSLQELKAAGISQAQARTIGIAVDVR
RTNKTAEGLKANADRLKEYKAKLILFPKKASAPKKGDSSAEELKVAAQLR
GDVLPLSHTITFDEPRQVTDAERKVEIFRLLRKERADKKYRGKREKRARE
AAEE

3D structure

PDB

9bh5 High-Resolution Reconstruction of a C. elegans Ribosome Sheds Light on Evolutionary Dynamics and Tissue Specificity.

Chain

Resolution

2.63 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CL	A30 R34	A29 R33
BS02	rna	CL	A2 P3 R4 G5 Q7 M8 N11 H13 F14 R15 K16 H17 W18 W25 Q28 P29 R31 K32 R34 R35 R36 R39 K42 R56 V59 R60 P62 Q63 Y66 T70 R71 R74 L78 K82 S87 D99 V100 R101 R102 T106 R151 H159 I161 F179 R180 R183 K184 R186 A187 K190 K194 R195 K197 R198	A1 P2 R3 G4 Q6 M7 N10 H12 F13 R14 K15 H16 W17 W24 Q27 P28 R30 K31 R33 R34 R35 R38 K41 R55 V58 R59 P61 Q62 Y65 T69 R70 R73 L77 K81 S86 D98 V99 R100 R101 T105 R150 H158 I160 F178 R179 R182 K183 R185 A186 K189 K193 R194 K196 R197

External links

PDB	RCSB:9bh5, PDBe:9bh5, PDBj:9bh5
PDBsum	9bh5
PubMed	39209556
UniProt	P91128\|RL13_CAEEL Large ribosomal subunit protein eL13 (Gene Name=rpl-13)

[Back to BioLiP]