Structure of PDB 8jiv Chain CL

Receptor sequence

>8jivCL (length=200) Species: 4565 (Triticum aestivum) [Search protein sequence]

VKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKNAVKIFPRPTS
GPLRPIVQCQTRKYNMKARAGRGFTLEELKSAGIPKKLAPTIGISVDHRR
KNRSLEGMQSNIQRLKTYKAKLVIFPRRARKVKAGDSTPEELANATQVQG
DYMPIARGEKRSVEVVKVTEEMKEFKAYGKLRVERMNQRQLGARQKKAAE

3D structure

PDB

8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.

Chain

Resolution

2.84 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CL	V2 K3 H4 N6 V7 P9 N10 H12 F13 K14 K15 H16 W17 K22 W24 Q27 P28 R30 K31 Q32 R34 R35 R38 R55 V58 Q59 C60 Q61 T62 Y65 N66 M67 K68 R70 G72 R73 L77 K88 D98 H99 R100 R101 K102 R104 S105 R128 V133 R158 E160 K161 R162 Y179 R183 R186 M187 R190 Q191 G193 R195	V1 K2 H3 N5 V6 P8 N9 H11 F12 K13 K14 H15 W16 K21 W23 Q26 P27 R29 K30 Q31 R33 R34 R37 R54 V57 Q58 C59 Q60 T61 Y64 N65 M66 K67 R69 G71 R72 L76 K87 D97 H98 R99 R100 K101 R103 S104 R127 V132 R157 E159 K160 R161 Y178 R182 R185 M186 R189 Q190 G192 R194
BS02	rna	CL	F25 N26 A29 R33	F24 N25 A28 R32

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jiv, PDBe:8jiv, PDBj:8jiv
PDBsum	8jiv
PubMed	38458197
UniProt	A0A3B6QBU0

[Back to BioLiP]