Structure of PDB 7nql Chain CL

Receptor sequence
>7nqlCL (length=45) Species: 9823 (Sus scrofa) [Search protein sequence]
EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTL
3D structure
PDB7nql Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
ChainCL
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide CL P25 K27 I28 L31 D34 L46 P16 K18 I19 L22 D25 L37
BS02 peptide CL I35 A36 L40 I26 A27 L31
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006390 mitochondrial transcription
GO:0006412 translation
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nql, PDBe:7nql, PDBj:7nql
PDBsum7nql
PubMed33878294
UniProtA0A4X1U6S6

[Back to BioLiP]