Structure of PDB 4w2f Chain CL

Receptor sequence

>4w2fCL (length=122) Species: 300852 (Thermus thermophilus HB8)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPK

3D structure

• PDB: 4w2f Amicoumacin a inhibits translation by stabilizing mRNA interaction with the ribosome.
• Chain: CL
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CL	P5 T6 N8 Q9 L10 R12 R15 E16 A30 P31 F32 R33 R34 K46 K47 N49 S50 L52 R53 T61 Y69 P71 G72 E73 R86 G87 K91 D92 R97 R113 K114 K115 S116 R117 S118 K119 K123 K124	P1 T2 N4 Q5 L6 R8 R11 E12 A26 P27 F28 R29 R30 K42 K43 N45 S46 L48 R49 T57 Y65 P67 G68 E69 R82 G83 K87 D88 R93 R109 K110 K111 S112 R113 S114 K115 K119 K120
BS02	MG	CL	T67 G95 V96 R97 Y98	T63 G91 V92 R93 Y94

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4w2f, PDBe:4w2f, PDBj:4w2f
• PDBsum: 4w2f
• PubMed: 25306919
• UniProt: Q5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)