Structure of PDB 4v9n Chain CL

Receptor sequence

>4v9nCL (length=122) Species: 262724 (Thermus thermophilus HB27)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPK

3D structure

• PDB: 4v9n Crystal Structure of the 70S Ribosome Bound with the Q253P Mutant Form of Release Factor RF2.
• Chain: CL
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CL	P4 T5 N7 Q8 L9 R11 R14 E15 K16 K19 K20 K22 K27 G28 P30 F31 R32 R33 K46 N48 S49 A50 L51 R52 K53 T60 Y68 P70 G71 E72 R85 G86 K90 D91 R96 R112 K113 K114 S115 R116 S117 K118 T121 K122 K123	P1 T2 N4 Q5 L6 R8 R11 E12 K13 K16 K17 K19 K24 G25 P27 F28 R29 R30 K43 N45 S46 A47 L48 R49 K50 T57 Y65 P67 G68 E69 R82 G83 K87 D88 R93 R109 K110 K111 S112 R113 S114 K115 T118 K119 K120

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9n, PDBe:4v9n, PDBj:4v9n
• PDBsum: 4v9n
• PubMed: 23769667
• UniProt: P61941|RS12_THET2 Small ribosomal subunit protein uS12 (Gene Name=rpsL)