Structure of PDB 4v5k Chain CL

Receptor sequence

>4v5kCL (length=124) Species: 300852 (Thermus thermophilus HB8)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEA

3D structure

• PDB: 4v5k Structural Basis for 16S Ribosomal RNA Cleavage by the Cytotoxic Domain of Colicin E3.
• Chain: CL
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CL	P2 T3 N5 Q6 R9 R12 E13 K14 R16 K17 K18 K25 A27 P28 F29 R30 R31 P42 K43 N46 S47 A48 L49 R50 T58 Y66 P68 G69 E70 L81 R83 G84 K88 D89 R94 R110 K111 K112 S113 R114 S115 K116 G118 K120	P1 T2 N4 Q5 R8 R11 E12 K13 R15 K16 K17 K24 A26 P27 F28 R29 R30 P41 K42 N45 S46 A47 L48 R49 T57 Y65 P67 G68 E69 L80 R82 G83 K87 D88 R93 R109 K110 K111 S112 R113 S114 K115 G117 K119
BS02	peptide	CL	R38 T39 V40 T41	R37 T38 V39 T40

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5k, PDBe:4v5k, PDBj:4v5k
• PDBsum: 4v5k
• PubMed: 20852642
• UniProt: Q5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)