Structure of PDB 8pv2 Chain CK

Receptor sequence

>8pv2CK (length=237) Species: 759272 (Thermochaetoides thermophila DSM 1495)

PQNEYIERHRKLHGRRLDAEERARKKAAREGHKNSENAQNLRGLRAKLYA
KQRHAQKIQMRKAIKQHEERNVPSDPIPSYLLDRANPTTAARFSVPIPKV
RGISEEEMFKVVKTGKKTHKKGWKRIVTKPTFVGPDFTRRPVKYERFIRP
MGLRYKKANVTHPTLNVTVQLPILSVKKNPSNPLYTQLGVLTKGTIIEVN
VSDLGIVTASGKIAWGRYAQITNNPENDGCVNAVLLV

3D structure

• PDB: 8pv2 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
• Chain: CK
• Resolution: 2.63 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CK	P2 Q3 E5 Y6 I7 E8 K12 R25 K26 A29 R30 H33 S36 A39 Q40 L42 R43 G44 L45 R46 K48 L49 A51 K52 R54 H55 K58 I59 F117 K123 R125 K134 V135 T138 G139 K140 K141 T142 H143 K145 W147 P159 F161 T162 R163 R164 V166 K167 Y168 E169 R170 F171 I172 R173 P174 M175 G176 N183 N190 T192 Q194 S199 V200 L208 T210 Q211 S234 T246 D252 N256	P1 Q2 E4 Y5 I6 E7 K11 R24 K25 A28 R29 H32 S35 A38 Q39 L41 R42 G43 L44 R45 K47 L48 A50 K51 R53 H54 K57 I58 F93 K99 R101 K110 V111 T114 G115 K116 K117 T118 H119 K121 W123 P135 F137 T138 R139 R140 V142 K143 Y144 E145 R146 F147 I148 R149 P150 M151 G152 N159 N166 T168 Q170 S175 V176 L184 T186 Q187 S210 T222 D228 N232

Gene Ontology

Biological Process

• GO:0000460 maturation of 5.8S rRNA
• GO:0000470 maturation of LSU-rRNA
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8pv2, PDBe:8pv2, PDBj:8pv2
• PDBsum: 8pv2
• PubMed: 37921038
• UniProt: G0S081