Structure of PDB 8i9y Chain CK

Receptor sequence

>8i9yCK (length=229) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

PQNEYIERHRKLHGRRLDAEERARKKAAREGHKNSENAQNLRGLRAKLYA
KQRHAQKIQMRKAIKQHEERNVKGTAKALSSQIKNKRAEKAARGISEEEM
FKVVKTGKKTHKKGWKRIVTKPTFVGPDFTRRPVKYERFIRPMGLRYKKA
NVTHPTLNVTVQLPILSVKKNPSNPLYTQLGVLTKGTIIEVNVSDLGIVT
ASGKIAWGRYAQITNNPENDGCVNAVLLV

3D structure

PDB

8i9y Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CK	P2 Q3 E5 Y6 I7 E8 R11 R23 R25 K26 A29 R30 H33 K34 S36 A39 Q40 R43 L45 K48 L49 A51 K52 R54 H55 K58 S103 K107 K140 T142 K145 R149 K167 Y168 R170 N183 T192 Q194 S205 N206 P207 L208 T246 D252 N256	P1 Q2 E4 Y5 I6 E7 R10 R22 R24 K25 A28 R29 H32 K33 S35 A38 Q39 R42 L44 K47 L48 A50 K51 R53 H54 K57 S80 K84 K108 T110 K113 R117 K135 Y136 R138 N151 T160 Q162 S173 N174 P175 L176 T214 D220 N224

Gene Ontology

	Biological Process
GO:0000460	maturation of 5.8S rRNA
GO:0000470	maturation of LSU-rRNA
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i9y, PDBe:8i9y, PDBj:8i9y
PDBsum	8i9y
PubMed	37129998
UniProt	G0S081

[Back to BioLiP]