Structure of PDB 8cre Chain CK

Receptor sequence
>8creCK (length=91) Species: 5476 (Candida albicans) [Search protein sequence]
TKRTKKVGITGKFGVRYGSSLRRQTKKLEVQQHAKYDCSFCGKRTVQRGA
TGIWNCKSCKKTVAGGAYTVSTAAAATVRSTIRRLRELAEA
3D structure
PDB8cre Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
ChainCK
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CK T2 R4 T5 K6 K7 V8 G9 I10 G12 K13 F14 G15 V16 R17 Y18 G19 S20 S21 R23 H34 F41 C42 K44 R49 A51 T52 K58 T1 R3 T4 K5 K6 V7 G8 I9 G11 K12 F13 G14 V15 R16 Y17 G18 S19 S20 R22 H33 F40 C41 K43 R48 A50 T51 K57
BS02 ZN CK C39 C42 C57 C60 C38 C41 C56 C59
External links
PDB RCSB:8cre, PDBe:8cre, PDBj:8cre
PDBsum8cre
PubMed
UniProtA0A1D8PP14|RL43A_CANAL Large ribosomal subunit protein eL43 (Gene Name=RPL43A)

[Back to BioLiP]