Structure of PDB 8cq7 Chain CK

Receptor sequence

>8cq7CK (length=91) Species: 5476 (Candida albicans)

TKRTKKVGITGKFGVRYGSSLRRQTKKLEVQQHAKYDCSFCGKRTVQRGA
TGIWNCKSCKKTVAGGAYTVSTAAAATVRSTIRRLRELAEA

3D structure

• PDB: 8cq7 Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
• Chain: CK
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CK	T2 R4 T5 K6 K7 V8 G9 I10 G12 K13 F14 G15 V16 R17 Y18 G19 S20 S21 L22 R23 H34 F41 C42 K44 R49 A51 T52	T1 R3 T4 K5 K6 V7 G8 I9 G11 K12 F13 G14 V15 R16 Y17 G18 S19 S20 L21 R22 H33 F40 C41 K43 R48 A50 T51
BS02	ZN	CK	C39 C42 C57 C60	C38 C41 C56 C59

External links

• PDB: RCSB:8cq7, PDBe:8cq7, PDBj:8cq7
• PDBsum: 8cq7
• UniProt: A0A1D8PP14|RL43A_CANAL Large ribosomal subunit protein eL43 (Gene Name=RPL43A)