Structure of PDB 4v9c Chain CK

Receptor sequence

>4v9cCK (length=117) Species: 83333 (Escherichia coli K-12)

RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRRV

3D structure

• PDB: 4v9c Allosteric control of the ribosome by small-molecule antibiotics.
• Chain: CK
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CK	K14 Q15 V16	K2 Q3 V4
BS02	rna	CK	H22 H24 N28 N29 I31 T33 T35 Q38 N40 A41 W44 T46 A47 G48 G49 R53 G54 K87 P115 I116 P117 H118 N119 G120 C121 R122 P124 K125 K126 R127 R128	H10 H12 N16 N17 I19 T21 T23 Q26 N28 A29 W32 T34 A35 G36 G37 R41 G42 K75 P103 I104 P105 H106 N107 G108 C109 R110 P112 K113 K114 R115 R116
BS03	rna	CK	R128 V129	R116 V117
BS04	rna	CK	S50 D72 K75 E76	S38 D60 K63 E64

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9c, PDBe:4v9c, PDBj:4v9c
• PDBsum: 4v9c
• PubMed: 22902368
• UniProt: P0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)