Structure of PDB 4v6c Chain CK

Receptor sequence
>4v6cCK (length=117) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRRV
3D structure
PDB4v6c Structures of the ribosome in intermediate States of ratcheting.
ChainCK
Resolution3.19 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CK H21 N27 N28 T32 G38 N39 A40 W43 T45 K56 K86 P114 P116 H117 N118 C120 R121 P123 K124 K125 R126 R127 H10 N16 N17 T21 G27 N28 A29 W32 T34 K45 K75 P103 P105 H106 N107 C109 R110 P112 K113 K114 R115 R116
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v6c, PDBe:4v6c, PDBj:4v6c
PDBsum4v6c
PubMed19696352
UniProtP0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]