Structure of PDB 4v5g Chain CK

Receptor sequence
>4v5gCK (length=119) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYA
AQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVD
DTPVPHNGCRPKKKFRKAS
3D structure
PDB4v5g The crystal structure of the ribosome bound to EF-Tu and aminoacyl-tRNA.
ChainCK
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CK Y20 N26 N27 I29 T31 G37 P39 I40 W42 G46 V47 G52 S53 K55 R85 P113 V114 P115 H116 N117 G118 R120 K122 K123 K124 R126 Y10 N16 N17 I19 T21 G27 P29 I30 W32 G36 V37 G42 S43 K45 R75 P103 V104 P105 H106 N107 G108 R110 K112 K113 K114 R116
BS02 rna CK Q13 K70 Q3 K60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5g, PDBe:4v5g, PDBj:4v5g
PDBsum4v5g
PubMed19833920
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]