Structure of PDB 4v56 Chain CK

Receptor sequence

>4v56CK (length=117) Species: 562 (Escherichia coli)

RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRRV

3D structure

• PDB: 4v56 A steric block in translation caused by the antibiotic spectinomycin.
• Chain: CK
• Resolution: 3.93 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CK	H21 N28 I30 T32 Q37 G38 N39 A40 W43 T45 G47 G48 R52 G53 P114 I115 P116 H117 N118 G119 C120 R121 P123 K124 K125 R126 R127 V128	H10 N17 I19 T21 Q26 G27 N28 A29 W32 T34 G36 G37 R41 G42 P103 I104 P105 H106 N107 G108 C109 R110 P112 K113 K114 R115 R116 V117

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v56, PDBe:4v56, PDBj:4v56
• PDBsum: 4v56
• PubMed: 17696316
• UniProt: P0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)