Structure of PDB 4u26 Chain CK

Receptor sequence
>4u26CK (length=117) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRRV
3D structure
PDB4u26 Synergy of streptogramin antibiotics occurs independently of their effects on translation.
ChainCK
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CK H22 N28 N29 I31 T33 G39 N40 A41 W44 T46 R53 G54 K57 K87 P115 P117 H118 N119 G120 C121 R122 P123 P124 K125 K126 R127 R128 H10 N16 N17 I19 T21 G27 N28 A29 W32 T34 R41 G42 K45 K75 P103 P105 H106 N107 G108 C109 R110 P111 P112 K113 K114 R115 R116
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4u26, PDBe:4u26, PDBj:4u26
PDBsum4u26
PubMed24957822
UniProtP0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]