Structure of PDB 1vy7 Chain CK

Receptor sequence
>1vy7CK (length=114) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
QVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQ
LAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDT
PVPHNGCRPKKKFR
3D structure
PDB1vy7 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.
ChainCK
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CK Y20 H22 N26 N27 I29 T31 G37 N38 P39 W42 S44 G46 G52 S53 K55 R85 V114 P115 H116 N117 G118 C119 R120 P121 K122 K123 Y8 H10 N14 N15 I17 T19 G25 N26 P27 W30 S32 G34 G40 S41 K43 R73 V102 P103 H104 N105 G106 C107 R108 P109 K110 K111
BS02 MG CK N26 K55 N14 K43
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1vy7, PDBe:1vy7, PDBj:1vy7
PDBsum1vy7
PubMed25132179
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]