Structure of PDB 9cai Chain CJ

Receptor sequence

>9caiCJ (length=186) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]

GDIEKQTEIREKKARNVMRELKIQKLCLNICVGESGDRLTRAAKVLEQLT
GQTPVFSKARYTVRTFGIRRNEKIAVHCTVRGPKAEEILEKGLKVKEYEL
YKENFSDTGNFGFGVQEHIDLGIKYDPSIGIYGMDFYVVLDRAGRRIAKR
RRAPGRVGPSHRVEREESIKWFQQKYDGIILPPKPK

3D structure

PDB

9cai High-Resolution Reconstruction of a C. elegans Ribosome Sheds Light on Evolutionary Dynamics and Tissue Specificity.

Chain

Resolution

2.59 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	CJ	T63 R70 R71	T62 R69 R70
BS02	rna	CJ	R11 K14 N17 M19 Q53 T54 V56 T80 R82 G145 R147 I148 R151 R157 G159 P160 H162	R10 K13 N16 M18 Q52 T53 V55 T79 R81 G144 R146 I147 R150 R156 G158 P159 H161
BS03	rna	CJ	K26 C28 N30 C32 G34 S58 A60 R61 T66 F67 I69 H78 E104 N105 S107 D108 G113 F114 G115 G134 M135 D136 Y138 R152 R157	K25 C27 N29 C31 G33 S57 A59 R60 T65 F66 I68 H77 E103 N104 S106 D107 G112 F113 G114 G133 M134 D135 Y137 R151 R156

External links

PDB	RCSB:9cai, PDBe:9cai, PDBj:9cai
PDBsum	9cai
PubMed	39209556
UniProt	Q19162\|RL112_CAEEL Large ribosomal subunit protein uL5B (Gene Name=rpl-11.2)

[Back to BioLiP]