Structure of PDB 8pv7 Chain CJ

Receptor sequence

>8pv7CJ (length=382) Species: 759272 (Thermochaetoides thermophila DSM 1495)

GKAKKKGKSGAARNYMTRTQAVKKLQLSLPDFRKLCIWKGIYPREPRDRR
KVNKSATASTTFYYTKDIQYLLHEPLLQKFREQKALEKKISRALGRGDVS
NAARLERNANLPEKTGKPRYTLNHIIRERYPTFQDALRDLDDCLSMLFLF
ANLPSTTAVPAKMIARCERLCHEFQHYLIVTHSLRKSFLSIKGIYYQANI
QGEDILWLVPYKFNQRIVGDVDFRIMGTFVEFYMTLLGFVNYRLYTSIGL
KYPPKFDQVKDDQGAELAAFSLEGLNDPSQLFANFTFFLSRETPRQPLEF
ILRAFGCKRIGWDAVLGEGAFTTDESDPRITHQIIDRPGRYPGRIYVQPQ
WVWDSINDEELKPPELYAPGAQLPPHLSPFVK

3D structure

• PDB: 8pv7 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
• Chain: CJ
• Resolution: 2.12 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CJ	G2 K3 A4 K5 K7 S10 A12 R19 T20 K24 S29 L30 P31 R34 R48 D49 R50 R51 K52 N54 K55 A59 K90 R93 R97 R105 V222 D223 R225	G1 K2 A3 K4 K6 S9 A11 R18 T19 K23 S28 L29 P30 R33 R47 D48 R49 R50 K51 N53 K54 A58 K89 R92 R96 R104 V221 D222 R224
BS02	rna	CJ	K3 S10 G11 A12 R14 N15 K25 Y65 Q70 H74 K85 K89 K90	K2 S9 G10 A11 R13 N14 K24 Y64 Q69 H73 K84 K88 K89

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0043021 ribonucleoprotein complex binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0030687 preribosome, large subunit precursor
• GO:0070545 PeBoW complex

External links

• PDB: RCSB:8pv7, PDBe:8pv7, PDBj:8pv7
• PDBsum: 8pv7
• PubMed: 37921038
• UniProt: G0SHX6