Structure of PDB 8oeq Chain CJ

Receptor sequence

>8oeqCJ (length=103) Species: 5476 (Candida albicans)

VNVPKTRKTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYG
GQTKQIFHKKAKTTKKVVLRLECVVCKTKAQLPLKRCKHFELGGDKKQKG
QAL

3D structure

• PDB: 8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
• Chain: CJ
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CJ	V2 N3 P5 R8 K9 T10 K13 K15 H20 Y28 A30 G31 A33 S34 F36 A37 Q38 G39 R41 R42 R45 K46 G49 Y50 G51 G52 Q53 T54 Q56 I57 F58 A62 K63 T65 K67 V69 T79 K80 Q82 P84 K86 R87 C88 K89 K97 K98 K100	V1 N2 P4 R7 K8 T9 K12 K14 H19 Y27 A29 G30 A32 S33 F35 A36 Q37 G38 R40 R41 R44 K45 G48 Y49 G50 G51 Q52 T53 Q55 I56 F57 A61 K62 T64 K66 V68 T78 K79 Q81 P83 K85 R86 C87 K88 K96 K97 K99
BS02	3K5	CJ	K40 Y43 K55 Q56 I57	K39 Y42 K54 Q55 I56

External links

• PDB: RCSB:8oeq, PDBe:8oeq, PDBj:8oeq
• PDBsum: 8oeq
• UniProt: A0A8H6BR69