Structure of PDB 8c3a Chain CJ

Receptor sequence

>8c3aCJ (length=103) Species: 5476 (Candida albicans) [Search protein sequence]

VNVPKTRKTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYG
GQTKQIFHKKAKTTKKVVLRLECVVCKTKAQLPLKRCKHFELGGDKKQKG
QAL

3D structure

PDB

8c3a New crystal system to promote screening for new eukaryotic inhibitors

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	CJ	V2 N3 P5 R8 K9 T10 K13 K15 H20 Y28 A30 G31 K32 A33 S34 F36 A37 Q38 G39 R41 R42 R45 K46 G49 Y50 G52 Q53 T54 K55 Q56 I57 F58 K60 A62 K63 T65 K67 V69 T79 K80 Q82 P84 K86 R87 C88 K89 K97 K98 K100	V1 N2 P4 R7 K8 T9 K12 K14 H19 Y27 A29 G30 K31 A32 S33 F35 A36 Q37 G38 R40 R41 R44 K45 G48 Y49 G51 Q52 T53 K54 Q55 I56 F57 K59 A61 K62 T64 K66 V68 T78 K79 Q81 P83 K85 R86 C87 K88 K96 K97 K99
BS02	3K5	CJ	K40 Y43 K55 Q56 I57	K39 Y42 K54 Q55 I56
BS03	ZN	CJ	C17 C74 C77	C16 C73 C76

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links