Structure of PDB 6zqd Chain CJ

Receptor sequence

>6zqdCJ (length=256) Species: 559292 (Saccharomyces cerevisiae S288C)

MLRRQARERREYLYRKAQELQDSQLQQKRQIIKQALAQVDDEYAATSGIM
DPRIIVTTSRDPSTRLSQFAKEIKLLFPNAVRLNRGNYVMPNLVDACKKS
GTTDLVVLHEHRGVPTSLTISHFPHGPTAQFSLHNVVMRHDIINAGNQSE
VNPHLIFDNFTTALGKRVVCILKHLFNAGPKKDSERVITFANRGDFISVR
QHVYVRTREGVEIAEVGPRFEMRLFELRLGTLENKDADVEWQLRRFIRTA
NKKDYL

3D structure

• PDB: 6zqd 90 S pre-ribosome transformation into the primordial 40 S subunit.
• Chain: CJ
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CJ	S93 R94 S97 T98 R99 Q102 K105 L109 R116 N118 R119 G120 N121 Y122 V123 H143 E144 R146 S166 N181 Q182 S183 R242 F259 R278 R279 F280 I281 R282 T283 K286 K287 L290	S59 R60 S63 T64 R65 Q68 K71 L75 R82 N84 R85 G86 N87 Y88 V89 H109 E110 R112 S132 N147 Q148 S149 R208 F225 R244 R245 F246 I247 R248 T249 K252 K253 L256

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0030515 snoRNA binding
• GO:0042134 rRNA primary transcript binding
• GO:0043047 single-stranded telomeric DNA binding

Biological Process

• GO:0006364 rRNA processing
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0030686 90S preribosome
• GO:0032040 small-subunit processome
• GO:0034457 Mpp10 complex
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6zqd, PDBe:6zqd, PDBj:6zqd
• PDBsum: 6zqd
• PubMed: 32943521
• UniProt: P53941|IMP4_YEAST U3 small nucleolar ribonucleoprotein protein IMP4 (Gene Name=IMP4)