Structure of PDB 5j88 Chain CJ

Receptor sequence
>5j88CJ (length=134) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
YVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPV
VITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQ
EIAQTKAADMTGADIEAMTRSIEGTARSMGLVVE
3D structure
PDB5j88 Resistance mutations generate divergent antibiotic susceptibility profiles against translation inhibitors.
ChainCJ
Resolution3.32 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CJ K10 L11 Q12 Q30 P75 A76 A77 K81 G89 G91 K92 P93 K95 K113 T118 G119 A124 R127 S128 G131 T132 S135 K3 L4 Q5 Q23 P68 A69 A70 K74 G82 G84 K85 P86 K88 K106 T111 G112 A117 R120 S121 G124 T125 S128
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006415 translational termination
GO:0015968 stringent response
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j88, PDBe:5j88, PDBj:5j88
PDBsum5j88
PubMed27382179
UniProtP0A7J7|RL11_ECOLI Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]