Structure of PDB 4v8x Chain CJ

Receptor sequence
>4v8xCJ (length=98) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRG
PFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
3D structure
PDB4v8x Yoeb-Ribosome Structure: A Canonical Rnase that Requires the Ribosome for its Specific Activity.
ChainCJ
Resolution3.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CJ R5 R9 H13 S35 G36 P37 I38 P39 L40 P41 T42 R43 V44 R45 T48 R51 G52 P53 F54 K55 H56 K57 S59 R60 H62 H68 R70 L71 D73 R3 R7 H11 S33 G34 P35 I36 P37 L38 P39 T40 R41 V42 R43 T46 R49 G50 P51 F52 K53 H54 K55 S57 R58 H60 H66 R68 L69 D71
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v8x, PDBe:4v8x, PDBj:4v8x
PDBsum4v8x
PubMed23945936
UniProtQ5SHN7|RS10_THET8 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]