Structure of PDB 4v8h Chain CJ

Receptor sequence
>4v8hCJ (length=96) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPF
KHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
3D structure
PDB4v8h How Hibernation Factors RMF, HPF, and YfiA Turn Off Protein Synthesis.
ChainCJ
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CJ R5 R9 H13 S35 P37 I38 P39 P41 T42 R43 V44 R46 R51 G52 F54 K55 H56 S59 R60 H62 R70 D73 R1 R5 H9 S31 P33 I34 P35 P37 T38 R39 V40 R42 R47 G48 F50 K51 H52 S55 R56 H58 R66 D69
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v8h, PDBe:4v8h, PDBj:4v8h
PDBsum4v8h
PubMed22605777
UniProtQ5SHN7|RS10_THET8 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]