Structure of PDB 8pv7 Chain CI

Receptor sequence

>8pv7CI (length=152) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

SQPGVMYIARLPHGFYEHELRGYFSQFGEITRLRVVRNKKTGASRHRAFI
EFADAEVADIAARTMDKYLLFGHILTCKIVPPAQVHPDLFKGANRRFKVV
PWNKMAGRQLERPLSESQWQVKVAKEEQRRAARAEKLKEMGYEFEAPALK
VP

3D structure

PDB

8pv7 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.12 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CI	Y190 R193 H201 R217 V218 V219 R220 N221 K222 K223 S227 R228 H229 R230 F254 H256 H269 L272 K274 G275 A276 R278 R279 F280 K281 V283 P284 W285 N286 R291 K305 R312 R316	Y7 R10 H18 R34 V35 V36 R37 N38 K39 K40 S44 R45 H46 R47 F71 H73 H86 L89 K91 G92 A93 R95 R96 F97 K98 V100 P101 W102 N103 R108 K122 R129 R133

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

	Cellular Component
GO:0005730	nucleolus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pv7, PDBe:8pv7, PDBj:8pv7
PDBsum	8pv7
PubMed	37921038
UniProt	G0S1H0

[Back to BioLiP]