Structure of PDB 8i9y Chain CI

Receptor sequence

>8i9yCI (length=146) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

SQPGVMYIARLPHGFYEHELRGYFSQFGEITRLRVVRNKKTGASRHRAFI
EFADAEVADIAARTMDKYLLFGHILTCKIVPPAQVHPDLFKGANRRFKVV
PWNKMAGRQLERPLSESQWQVKVAKEEQRRAARAEKLKEMGYEFEA

3D structure

PDB

8i9y Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CI	Y190 R193 H201 R217 V218 V219 R220 N221 K222 K223 H229 R230 F254 H256 H269 D271 L272 K274 R278 R279 F280 K281 V283 K287 M288 R291 K305 R312 R316	Y7 R10 H18 R34 V35 V36 R37 N38 K39 K40 H46 R47 F71 H73 H86 D88 L89 K91 R95 R96 F97 K98 V100 K104 M105 R108 K122 R129 R133

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

	Cellular Component
GO:0005730	nucleolus

External links