Structure of PDB 6tba Chain CH |
>6tbaCH (length=84) Species: 272942 (Rhodobacter capsulatus SB 1003) [Search protein sequence] |
MDVFAKHAVSLESPAVRHYEITPSDSTDLARRPRALRVQTGGTLVLRDET GITVTYTVFAGEILPVRPVRVLATGTTATAVGWE |
|
PDB | 6tba Structure and mechanism of DNA delivery of a gene transfer agent. |
Chain | CH |
Resolution | 4.54 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
CH |
A35 P65 |
A35 P65 |
|
|
|