Structure of PDB 4v9n Chain CH

Receptor sequence
>4v9nCH (length=138) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYER
VDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEI
PRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW
3D structure
PDB4v9n Crystal Structure of the 70S Ribosome Bound with the Q253P Mutant Form of Release Factor RF2.
ChainCH
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CH M1 T3 A7 D8 T11 R12 R14 N15 K21 A28 S29 R30 F31 K56 K88 P89 G90 R92 Y94 V97 S113 T114 S115 G128 V129 G130 E132 M1 T3 A7 D8 T11 R12 R14 N15 K21 A28 S29 R30 F31 K56 K88 P89 G90 R92 Y94 V97 S113 T114 S115 G128 V129 G130 E132
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9n, PDBe:4v9n, PDBj:4v9n
PDBsum4v9n
PubMed23769667
UniProtP62668|RS8_THET2 Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]