Structure of PDB 4v83 Chain CH

Receptor sequence

>4v83CH (length=138) Species: 262724 (Thermus thermophilus HB27)

MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYER
VDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEI
PRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW

3D structure

• PDB: 4v83 Crystal structures of complexes containing domains from two viral internal ribosome entry site (IRES) RNAs bound to the 70S ribosome.
• Chain: CH
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CH	M1 L2 T3 P5 T11 R12 R14 N15 K21 A28 S29 R30 F31 K56 K88 P89 G90 R91 R92 Y94 V95 G96 V97 S113 T114 S115 K116 G128 V129 G130 E132	M1 L2 T3 P5 T11 R12 R14 N15 K21 A28 S29 R30 F31 K56 K88 P89 G90 R91 R92 Y94 V95 G96 V97 S113 T114 S115 K116 G128 V129 G130 E132

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v83, PDBe:4v83, PDBj:4v83
• PDBsum: 4v83
• PubMed: 21245352
• UniProt: P62668|RS8_THET2 Small ribosomal subunit protein uS8 (Gene Name=rpsH)