Structure of PDB 4v5g Chain CH

Receptor sequence

>4v5gCH (length=138) Species: 300852 (Thermus thermophilus HB8)

MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYER
VDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEI
PRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW

3D structure

• PDB: 4v5g The crystal structure of the ribosome bound to EF-Tu and aminoacyl-tRNA.
• Chain: CH
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CH	M1 T3 D8 T11 R12 N15 V19 S29 R30 F31 K56 R75 K88 P89 G90 R92 Y94 G96 V97 S113 T114 S115 G128 G130 E132	M1 T3 D8 T11 R12 N15 V19 S29 R30 F31 K56 R75 K88 P89 G90 R92 Y94 G96 V97 S113 T114 S115 G128 G130 E132

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 05:17:47 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v5g', asym_id = 'CH', title = 'The crystal structure of the ribosome bound to EF-Tu and aminoacyl-tRNA.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v5g', asym_id='CH', title='The crystal structure of the ribosome bound to EF-Tu and aminoacyl-tRNA.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v5g', asym_id = 'CH'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v5g', asym_id='CH')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>