Structure of PDB 4u24 Chain CH

Receptor sequence

>4u24CH (length=129) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKV
EGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGI
AVVSTSKGVMTDRAARQAGLGGEIICYVA

3D structure

PDB

4u24 Synergy of streptogramin antibiotics occurs independently of their effects on translation.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CH	S2 M3 Q4 D5 P6 A8 D9 T12 R13 R15 N16 K22 S30 K31 L32 K56 Q76 R80 P81 R84 Y86 R88 K89 S105 T106 S107 K108 G120 L121 G122 E124	S1 M2 Q3 D4 P5 A7 D8 T11 R12 R14 N15 K21 S29 K30 L31 K55 Q75 R79 P80 R83 Y85 R87 K88 S104 T105 S106 K107 G119 L120 G121 E123

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006417	regulation of translation
GO:0043488	regulation of mRNA stability

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4u24, PDBe:4u24, PDBj:4u24
PDBsum	4u24
PubMed	24957822
UniProt	P0A7W7\|RS8_ECOLI Small ribosomal subunit protein uS8 (Gene Name=rpsH)