Structure of PDB 9bh5 Chain CG

Receptor sequence

>9bh5CG (length=221) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]

KNPLFEKRARNFNIGQDIQPKKDVTRFVKWPKYIRLQRQSAILQKRLKVP
PTINQFRTALDSQSARQAFKLLDKYRPESTEAKKNRLRARAEARPNTVRH
GVNTITRLVETRRAQLVLIAHDVNPLEIVLHLPALCRKYNVPYAIIKGKA
SLGTVVRRKTTAAVALVDVNPEDKSALNKLVETVNNNFSERHEEIRKHWG
GGVMSAKSDAKKLKIERARAR

3D structure

PDB

9bh5 High-Resolution Reconstruction of a C. elegans Ribosome Sheds Light on Evolutionary Dynamics and Tissue Specificity.

Chain

Resolution

2.63 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CG	Y61 I62 Q65 R66 R94 H160 K186	Y33 I34 Q37 R38 R66 H121 K147
BS02	rna	CG	E34 K35 R36 R38 F40 I42 Q44 Q47 P48 K49 K50 V52 R54 F55 K57 P59 Y61 R66 I70 L71 R74 L75 K112 H139 G140 V141 N142 T143 R146 N163 I167 K188 A189 R197 K198 T199 T200 A201 S244 K246	E6 K7 R8 R10 F12 I14 Q16 Q19 P20 K21 K22 V24 R26 F27 K29 P31 Y33 R38 I42 L43 R46 L47 K84 H100 G101 V102 N103 T104 R107 N124 I128 K149 A150 R158 K159 T160 T161 A162 S205 K207

External links

PDB	RCSB:9bh5, PDBe:9bh5, PDBj:9bh5
PDBsum	9bh5
PubMed	39209556
UniProt	Q966C6\|RL7A_CAEEL Large ribosomal subunit protein eL8 (Gene Name=rpl-7A)

[Back to BioLiP]