Structure of PDB 8oeq Chain CG

Receptor sequence
>8oeqCG (length=50) Species: 5476 (Candida albicans) [Search protein sequence]
PSQKSFRTKQKLAKAQKQNRPLPQWIRLRTDNKIRYNAKRRHWRRTKLGI
3D structure
PDB8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
ChainCG
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CG P2 S3 Q4 K5 K10 L13 Q17 P22 A39 R41 R42 H43 W44 R45 K48 L49 P1 S2 Q3 K4 K9 L12 Q16 P21 A38 R40 R41 H42 W43 R44 K47 L48
BS02 rna CG F7 R8 K12 K15 K18 Q19 R21 L23 W26 I27 L29 R30 T31 K40 F6 R7 K11 K14 K17 Q18 R20 L22 W25 I26 L28 R29 T30 K39
External links
PDB RCSB:8oeq, PDBe:8oeq, PDBj:8oeq
PDBsum8oeq
PubMed
UniProtQ96W55|RL39_CANAX Large ribosomal subunit protein eL39 (Gene Name=RPL39)

[Back to BioLiP]