Structure of PDB 7ajt Chain CG

Receptor sequence

>7ajtCG (length=123) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFI
IMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASI
TTNDASAIKTQIYAVKDKIETLL

3D structure

PDB

7ajt Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

Chain

Resolution

4.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CG	K35 A37 N38 E39 K42 V93 S94 R95 I98	K33 A35 N36 E37 K40 V91 S92 R93 I96

Gene Ontology

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000398	mRNA splicing, via spliceosome
GO:0000452	snoRNA guided rRNA 2'-O-methylation
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000494	box C/D sno(s)RNA 3'-end processing
GO:0006364	rRNA processing
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0030490	maturation of SSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005687	U4 snRNP
GO:0005730	nucleolus
GO:0031428	box C/D methylation guide snoRNP complex
GO:0032040	small-subunit processome
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071001	U4/U6 snRNP
GO:0071011	precatalytic spliceosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7ajt, PDBe:7ajt, PDBj:7ajt
PDBsum	7ajt
PubMed	33326748
UniProt	P39990\|SNU13_YEAST 13 kDa ribonucleoprotein-associated protein (Gene Name=SNU13)