Structure of PDB 4wpo Chain CG

Receptor sequence

>4wpoCG (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4wpo Conformational Changes of Elongation Factor G on the Ribosome during tRNA Translocation.
• Chain: CG
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CG	K36 N40 G42 L43 E45 T71 A73 F80 I88 S124 D126 R128 N132 L133 G134 L135 G154 D156 A158	K35 N39 G41 L42 E44 T70 A72 F79 I87 S123 D125 R127 N131 L132 G133 L134 G153 D155 A157
BS02	rna	CG	P2 N27 W29 E30 Q66 K67 A69 V70 R91 V92 T93 R95 R96	P1 N26 W28 E29 Q65 K66 A68 V69 R90 V91 T92 R94 R95
BS03	MG	CG	T161 T162	T160 T161

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wpo, PDBe:4wpo, PDBj:4wpo
• PDBsum: 4wpo
• PubMed: 25594181
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)