Structure of PDB 4v7u Chain CG

Receptor sequence
>4v7uCG (length=150) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQ
RSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMR
WIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAFA
3D structure
PDB4v7u Structures of the Escherichia coli ribosome with antibiotics bound near the peptidyl transferase center explain spectra of drug action.
ChainCG
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CG R2 R3 R9 K24 N27 L29 M30 V31 D32 G33 K34 S36 T37 I41 R77 R101 R108 K113 S114 M115 R118 R1 R2 R8 K23 N26 L28 M29 V30 D31 G32 K33 S35 T36 I40 R76 R100 R107 K112 S113 M114 R117
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7u, PDBe:4v7u, PDBj:4v7u
PDBsum4v7u
PubMed20876128
UniProtP02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]