Structure of PDB 4v53 Chain CG

Receptor sequence
>4v53CG (length=152) Species: 562 (Escherichia coli) [Search protein sequence]
RRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQ
RSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMR
WIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAFA
HY
3D structure
PDB4v53 Structural basis for aminoglycoside inhibition of bacterial ribosome recycling.
ChainCG
Resolution3.54 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CG R2 R3 I6 R9 K24 N27 L29 M30 V31 D32 G33 K34 K35 S36 I41 K75 R77 R78 R101 R108 K113 S114 M115 R1 R2 I5 R8 K23 N26 L28 M29 V30 D31 G32 K33 K34 S35 I40 K74 R76 R77 R100 R107 K112 S113 M114
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0016020 membrane
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v53, PDBe:4v53, PDBj:4v53
PDBsum4v53
PubMed17660832
UniProtP02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]