Structure of PDB 8pv4 Chain CF

Receptor sequence
>8pv4CF (length=245) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]
PKSKRARVYHLTQVNKKGREAKERLFSNIRETIPKYQHCFVFSVDNMRNN
YLKDVRHELNDCRIFFGKTKLMARALGTTPEEEQADGLHRLTRYLTGTVG
LLFTNRDPADIESYFSNLSQVDFARAGTVAPRTVTVPPGIVYSTGGEVPP
EHDVPVSHTLEPELRRLGMPVRMIKGKVCLGDEKGEASEGYTICKEGEVL
DSRQTRLLKLFSICLSEFKVSLLGYWSSASGEVTELEAGKTRPKR
3D structure
PDB8pv4 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
ChainCF
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CF K3 S4 K5 R6 A7 R8 H11 T13 Q14 V15 N16 K17 K18 R20 F27 R49 K54 R57 R64 F66 F67 K69 T70 K71 R75 R126 T160 S203 T206 R207 K210 K2 S3 K4 R5 A6 R7 H10 T12 Q13 V14 N15 K16 K17 R19 F26 R48 K53 R56 R63 F65 F66 K68 T69 K70 R74 R125 T159 S202 T205 R206 K209
Gene Ontology
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006364 rRNA processing
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pv4, PDBe:8pv4, PDBj:8pv4
PDBsum8pv4
PubMed37921038
UniProtG0S616|MRT4_CHATD Large ribosomal subunit protein uL10 (Gene Name=CTHT_0025680)

[Back to BioLiP]