Structure of PDB 8jiv Chain CF

Receptor sequence

>8jivCF (length=234) Species: 4565 (Triticum aestivum) [Search protein sequence]

PEKVILKRRREEVWAAEKKQKVAAEKIKAAENTKVIYARAEQYAGEYEAQ
DKELVQLKREARMKGGFYVSPEAKLLFVVRIRGINAMHPKTKKILQLLRL
RQIFNGVFLKVNKATINMLRRVEPYVAYGYPNLKSVRELIYKRGYGKLNK
QRIPLANNKVIEEGLGKHNIICIEDLVHEILTVGPHFKEANNFLWPFKLK
APLGGLKKKRNHYVEGGDAGNRENYINQLVRRMN

3D structure

PDB

8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.

Chain

Resolution

2.84 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CF	K13 L16 K17 R20 R69 R72 R92 G93 I94 N95 A96 M97 P99 K100 K103 I104 L107 Q112 I113 K120 A124 N127 M128 R131 K144 K152 K160 Q161 R162 K198 N202 K208 L209 K210 A211 P212 L213 G214 G215 K219 Q238 R241	K3 L6 K7 R10 R59 R62 R82 G83 I84 N85 A86 M87 P89 K90 K93 I94 L97 Q102 I103 K110 A114 N117 M118 R121 K134 K142 K150 Q151 R152 K188 N192 K198 L199 K200 A201 P202 L203 G204 G205 K209 Q228 R231
BS02	rna	CF	R130 R220 H222 V224 E225	R120 R210 H212 V214 E215

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

	Cellular Component
GO:0022625	cytosolic large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jiv, PDBe:8jiv, PDBj:8jiv
PDBsum	8jiv
PubMed	38458197
UniProt	A0A3B6DM38

[Back to BioLiP]