Structure of PDB 6xu7 Chain CF

Receptor sequence

>6xu7CF (length=226) Species: 7227 (Drosophila melanogaster)

KQISKRVAESKRRLKKAAVIALRKKENLVRAEKYQNEYIKAEQREIKLRR
LAKKRNQFYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFI
KLNKATINMLRIAEPYITWGYPNLKSVRELIYKRGFVKHNRQRVPITDNF
VIERKLRQAHQIQCVEDLVHEIFTVGPNFKYASNFLWPFKLNTPTGGWRK
KANHYVNGGDFGNREDQINRLLRKMV

3D structure

• PDB: 6xu7 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.
• Chain: CF
• Resolution: 4.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CF	R137 K226 H230 V232	R111 K200 H204 V206
BS02	rna	CF	Q28 I29 R32 K42 K66 R70 I72 K73 R75 R76 K79 R81 R99 G100 I101 N102 K103 P106 K110 L114 F115 R116 R118 Q119 I120 K127 A131 N134 M135 N149 K151 R160 F162 Q168 R169 F176 R180 K181 R183 K206 N210 K216 L217 N218 T219 T221 G222 G223 W224 R249	Q2 I3 R6 K16 K40 R44 I46 K47 R49 R50 K53 R55 R73 G74 I75 N76 K77 P80 K84 L88 F89 R90 R92 Q93 I94 K101 A105 N108 M109 N123 K125 R134 F136 Q142 R143 F150 R154 K155 R157 K180 N184 K190 L191 N192 T193 T195 G196 G197 W198 R223

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0035073 pupariation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6xu7, PDBe:6xu7, PDBj:6xu7
• PDBsum: 6xu7
• PubMed: 34283226
• UniProt: P32100|RL7_DROME Large ribosomal subunit protein uL30 (Gene Name=RpL7)