Structure of PDB 6rxu Chain CF

Receptor sequence

>6rxuCF (length=120) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence]

AAWPKAEDPALVQELLDCVQQASHYRQLKKGANETTKSVNRGTSELVILA
ADTQPLSIVLHIPLICEEKNVPYVYVPSKVALGRACGVSRAVIAVSLTSN
EASDLNSKIRALRDKVERLA

3D structure

PDB

6rxu Thermophile 90S Pre-ribosome Structures Reveal the Reverse Order of Co-transcriptional 18S rRNA Subdomain Integration.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CF	K36 G37 A38 N39 E40 K43 R47 T59 Q60 V94 R96 V98 I99	K30 G31 A32 N33 E34 K37 R41 T53 Q54 V88 R90 V92 I93

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0000398	mRNA splicing, via spliceosome
GO:0000470	maturation of LSU-rRNA
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0030490	maturation of SSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005730	nucleolus
GO:0022625	cytosolic large ribosomal subunit
GO:0031428	box C/D methylation guide snoRNP complex
GO:0032040	small-subunit processome
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071011	precatalytic spliceosome
GO:1990904	ribonucleoprotein complex

External links