Structure of PDB 4v7e Chain CF

Receptor sequence

>4v7eCF (length=244) Species: 4565 (Triticum aestivum)

MASEAAKVAVPEKVILKRRREEVWAAEKKQKVAAEKIKAAENTKVIYARA
EQYAGEYEAQDKELVQLKREARMKGGFYVSPEAKPLFVVRIRGINAMHPK
TKKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVTYGYPNLKSVRELI
YKRGYGKLNKQRIPLANNKVIEEGLGKHNIICIEDLVHEILTVGPHFKEA
NNFLWPFKLKAPLGGLKKKRNHYVEGGDAGNRENYINQLVRRMN

3D structure

• PDB: 4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.
• Chain: CF
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CF	S3 K7 P99 K100 K103 I104 L107 R109 K120 K123 A124 N127 M128 R131 Q161 W205 K219 Q238 R241	S3 K7 P99 K100 K103 I104 L107 R109 K120 K123 A124 N127 M128 R131 Q161 W205 K219 Q238 R241
BS02	rna	CF	H98 R130 E133 R220 H222 Y223 V224 E225	H98 R130 E133 R220 H222 Y223 V224 E225

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:4v7e, PDBe:4v7e, PDBj:4v7e
• PDBsum: 4v7e
• PubMed: 24499919
• UniProt: Q5I7K6