Structure of PDB 8k2c Chain CE

Receptor sequence
>8k2cCE (length=73) Species: 9606 (Homo sapiens) [Search protein sequence]
NTKSAAARARRAEAKAAADAKKQKELEDAYWKDDDKHVMRKEQRKEEKEK
RRLDQLERKKETQRLLEEEDSKL
3D structure
PDB8k2c Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainCE
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CE R18 H45 R48 K49 R52 R59 R60 L64 R66 K67 R10 H37 R40 K41 R44 R51 R52 L56 R58 K59
BS02 rna CE K11 S12 K3 S4
Gene Ontology
Molecular Function
GO:0003713 transcription coactivator activity
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0006366 transcription by RNA polymerase II
GO:0045893 positive regulation of DNA-templated transcription
GO:0051301 cell division
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0030496 midbody

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k2c, PDBe:8k2c, PDBj:8k2c
PDBsum8k2c
PubMed38942792
UniProtQ96CT7|CC124_HUMAN Coiled-coil domain-containing protein 124 (Gene Name=CCDC124)

[Back to BioLiP]