Structure of PDB 4wt8 Chain CE

Receptor sequence

>4wt8CE (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4wt8 Bactobolin A Binds to a Site on the 70S Ribosome Distinct from Previously Seen Antibiotics.
• Chain: CE
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CE	S76 S78 R83	S75 S77 R82
BS02	rna	CE	K36 N40 L43 T71 K74 K75 I77 N79 R91 S124 D126 R128 N132 L133 L135 G154 D156	K35 N39 L42 T70 K73 K74 I76 N78 R90 S123 D125 R127 N131 L132 L134 G153 D155
BS03	rna	CE	N27 W29 Q66 K67 A69 V70 V92 T93 R95 R96	N26 W28 Q65 K66 A68 V69 V91 T92 R94 R95

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wt8, PDBe:4wt8, PDBj:4wt8
• PDBsum: 4wt8
• PubMed: 25562208
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)