Structure of PDB 4v9j Chain CE

Receptor sequence
>4v9jCE (length=151) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLA
VQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGA
VPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
E
3D structure
PDB4v9j Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
ChainCE
Resolution3.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CE R14 T16 A17 M19 A21 R24 R27 K57 Y60 Y61 F84 G85 A94 A95 I101 A102 L119 T120 K121 E122 L123 S125 R126 N127 I129 Y133 R10 T12 A13 M15 A17 R20 R23 K53 Y56 Y57 F80 G81 A90 A91 I97 A98 L115 T116 K117 E118 L119 S121 R122 N123 I125 Y129
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9j, PDBe:4v9j, PDBj:4v9j
PDBsum4v9j
PubMed23812722
UniProtP62665|RS5_THET2 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]